Pay in 4 interest-free payments of $287.18 Learn more
Ships within 48 hours · Estimated delivery Aug 26 - Aug 31
Via its interaction with PDCD6IP involved in HIV-1 p6- and p9-dependent virus release
Vartiainen E
Protein Names:Recommended name: Uncharacterized membrane protein ymcC
AA Sequence:MRFKNRLFWIAAFIAFFVDQLTKYWVVQTFSLGETLPILPGIFHFTYVTNTGAAFSLFSG KVEWLRWLSLGVSLLLIGLALLGPVLERWDQLGYGLILGGAMGNGIDRFALGYVVDFLDF RLINFAVFNMADSFISIGIVCLLLASLQKSPDSHHRSR
Recombinant Salmonella paratyphi C 4-hydroxybenzoate octaprenyltransferase(ubiA) RNA Isolation; General RNA Isolation Via its interaction with PDCD6IPSize: 50 ug. Other sizes are also available. Product Type: Recombinant Protein Species: Salmonella paratyphi C (strain RKS4594) Uniprot NO.: C0Q4D9 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris based buffer,50% glycerol, optimized for this protein Storage: Store at 20, for extended storage, conserve at 20 or 80. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 for up to
US$ 190.00
US$ 30.00
US$ 65.00
US$ 65.00
US$ 45.00
US$ 200.00
US$ 88.00
US$ 125.00
